VEGF C Rat

Catalog No.: AP3712
Vascular Endothelial Growth Factor Related Protein Rat Recombinant
Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
Grouped product items
Product Name Price Stock Qty
VEGF C Rat 2µg
$110.00
In stock
VEGF C Rat 10µg
$290.00
In stock
VEGF C Rat 1mg
$11,220.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3712
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.
Amino acid sequence DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH.
Uniprot ACC# P16612
Purity Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Stability Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Source Sf9, Insect Cells.
Synonyms VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.
Transportation method Shipped at Room temp