VEGF C Rat

Catalog No.: AP3712
Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
Grouped product items
Size Price Stock Qty
2µg
$110.00
In stock
10µg
$290.00
In stock
1000µg
$11,220.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Protein Information
Catalog NumAP3712
Physical appearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationEach mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.
Amino acid sequenceDTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH.
Uniprot ACC#P16612
PurityGreater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
StabilityLyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
SourceSf9, Insect Cells.
SynonymsVEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.
Transportation methodShipped at Room temp