VEGFC Human HEK

Catalog No.: AP3727
Vascular Endothelial Growth Factor C Human Recombinant HEK
VEGFC Human Recombinant produced by transfected human cells is a single polypeptide chain containing 204 amino acids (32-227). VEGFC is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
VEGFC Human HEK 5µg
$110.00
In stock
VEGFC Human HEK 20µg
$290.00
In stock
VEGFC Human HEK 1mg
$5,940.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3727
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation VEGFC was lyophilized from a 0.2 µM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2.
Amino acid sequence FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH.
Uniprot ACC# P49767
Purity Greater than 95% as determined by SDS-PAGE.
Stability Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Source HEK293 cells.
Synonyms VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L, Vascular endothelial growth factor-related protein, VEGFC.
Transportation method Shipped at Room temp